SCOPe 2.03: Domain d2wquc2: 2wqu C:241-318

Lineage for d2wquc2 (2wqu C:241-318)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (22 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries)

8. Domain d2wquc2: 2wqu C:241-318 [206949]
   Other proteins in same PDB: d2wqua1, d2wqub1, d2wquc1, d2wqud1, d2wque1, d2wquf1
   automated match to d1m9sa1
   complexed with gol, so4

Details for d2wquc2

PDB Entry: 2wqu, 2.6 Å

PDB Description: internalin domain of listeria monocytogenes inlb: triclinic crystal form

PDB Compounds: (C:) internalin b

SCOPe Domain Sequences for d2wquc2:

Sequence, based on SEQRES records:

>d2wquc2 b.1.18.0 (C:241-318) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqp

Sequence, based on observed residues (ATOM records):

>d2wquc2 b.1.18.0 (C:241-318) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpipntvkntdgslvtpeiisddgdyekpnvsfifyqpvtigkakarfhgrvtqp

Timeline for d2wquc2:

• d2wquc2 is new in SCOPe 2.03-stable
  
• d2wquc2 appears in SCOPe 2.04
  
• d2wquc2 appears in the current release, SCOPe 2.08