Lineage for d2wqub2 (2wqu B:241-320)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1300237Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1300238Protein automated matches [190226] (22 species)
    not a true protein
  7. 1300299Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries)
  8. 1300307Domain d2wqub2: 2wqu B:241-320 [206947]
    Other proteins in same PDB: d2wqua1, d2wqub1, d2wquc1, d2wqud1, d2wque1, d2wquf1
    automated match to d1m9sa1
    complexed with gol, so4

Details for d2wqub2

PDB Entry: 2wqu (more details), 2.6 Å

PDB Description: internalin domain of listeria monocytogenes inlb: triclinic crystal form
PDB Compounds: (B:) internalin b

SCOPe Domain Sequences for d2wqub2:

Sequence, based on SEQRES records: (download)

>d2wqub2 b.1.18.0 (B:241-320) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplk

Sequence, based on observed residues (ATOM records): (download)

>d2wqub2 b.1.18.0 (B:241-320) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhnevsfifyqpvtig
kakarfhgrvtqplk

SCOPe Domain Coordinates for d2wqub2:

Click to download the PDB-style file with coordinates for d2wqub2.
(The format of our PDB-style files is described here.)

Timeline for d2wqub2: