Lineage for d2woxb_ (2wox B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141444Species Pseudomonas aeruginosa [TaxId:287] [225751] (7 PDB entries)
  8. 2141468Domain d2woxb_: 2wox B: [206940]
    automated match to d1o9ja_
    complexed with 7pe, bme, gol, k, ndp

Details for d2woxb_

PDB Entry: 2wox (more details), 2.3 Å

PDB Description: betaine aldehyde dehydrogenase from pseudomonas aeruginosa with nad(p)h-catalytic thiol adduct.
PDB Compounds: (B:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d2woxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2woxb_ c.82.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
elgdyasvf

SCOPe Domain Coordinates for d2woxb_:

Click to download the PDB-style file with coordinates for d2woxb_.
(The format of our PDB-style files is described here.)

Timeline for d2woxb_: