Lineage for d1bd2a1 (1bd2 A:182-275)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103286Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 103303Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (28 PDB entries)
  8. 103350Domain d1bd2a1: 1bd2 A:182-275 [20694]
    Other proteins in same PDB: d1bd2a2, d1bd2d1, d1bd2d2, d1bd2e1, d1bd2e2

Details for d1bd2a1

PDB Entry: 1bd2 (more details), 2.5 Å

PDB Description: complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201

SCOP Domain Sequences for d1bd2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd2a1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1bd2a1:

Click to download the PDB-style file with coordinates for d1bd2a1.
(The format of our PDB-style files is described here.)

Timeline for d1bd2a1: