Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (28 PDB entries) |
Domain d1bd2a1: 1bd2 A:182-275 [20694] Other proteins in same PDB: d1bd2a2, d1bd2d1, d1bd2d2, d1bd2e1, d1bd2e2 |
PDB Entry: 1bd2 (more details), 2.5 Å
SCOP Domain Sequences for d1bd2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bd2a1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d1bd2a1: