Class b: All beta proteins [48724] (174 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) automatically mapped to Pfam PF01179 |
Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins) |
Protein Copper amine oxidase, domain 3 [50000] (4 species) |
Species Escherichia coli [TaxId:562] [50001] (16 PDB entries) |
Domain d2woha4: 2woh A:301-725 [206934] Other proteins in same PDB: d2woha1, d2woha2, d2woha3, d2wohb1, d2wohb2, d2wohb3 automated match to d1d6zb1 complexed with ca, cu, sr |
PDB Entry: 2woh (more details), 2.7 Å
SCOPe Domain Sequences for d2woha4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2woha4 b.30.2.1 (A:301-725) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]} pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl galkk
Timeline for d2woha4:
View in 3D Domains from other chains: (mouse over for more information) d2wohb1, d2wohb2, d2wohb3, d2wohb4 |