Lineage for d2woha3 (2woh A:186-300)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935960Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2935961Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2935962Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2936092Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 2936130Domain d2woha3: 2woh A:186-300 [206933]
    Other proteins in same PDB: d2woha1, d2woha4, d2wohb1, d2wohb4
    automated match to d1d6zb3
    complexed with ca, cu, sr

Details for d2woha3

PDB Entry: 2woh (more details), 2.7 Å

PDB Description: strontium soaked e. coli copper amine oxidase
PDB Compounds: (A:) primary amine oxidase

SCOPe Domain Sequences for d2woha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2woha3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOPe Domain Coordinates for d2woha3:

Click to download the PDB-style file with coordinates for d2woha3.
(The format of our PDB-style files is described here.)

Timeline for d2woha3: