Lineage for d2wofb4 (2wof B:301-726)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781475Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2781476Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2781477Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2781543Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 2781551Domain d2wofb4: 2wof B:301-726 [206930]
    Other proteins in same PDB: d2wofa1, d2wofa2, d2wofa3, d2wofb1, d2wofb2, d2wofb3
    automated match to d1oacb1
    complexed with cu, na

Details for d2wofb4

PDB Entry: 2wof (more details), 2.25 Å

PDB Description: edta treated e. coli copper amine oxidase
PDB Compounds: (B:) primary amine oxidase

SCOPe Domain Sequences for d2wofb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wofb4 b.30.2.1 (B:301-726) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkkd

SCOPe Domain Coordinates for d2wofb4:

Click to download the PDB-style file with coordinates for d2wofb4.
(The format of our PDB-style files is described here.)

Timeline for d2wofb4: