![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) ![]() automatically mapped to Pfam PF01179 |
![]() | Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins) |
![]() | Protein Copper amine oxidase, domain 3 [50000] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [50001] (16 PDB entries) |
![]() | Domain d2wofa4: 2wof A:301-725 [206926] Other proteins in same PDB: d2wofa1, d2wofa2, d2wofa3, d2wofb1, d2wofb2, d2wofb3 automated match to d1d6zb1 complexed with cu, na |
PDB Entry: 2wof (more details), 2.25 Å
SCOPe Domain Sequences for d2wofa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wofa4 b.30.2.1 (A:301-725) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]} pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl galkk
Timeline for d2wofa4:
![]() Domains from other chains: (mouse over for more information) d2wofb1, d2wofb2, d2wofb3, d2wofb4 |