Lineage for d2woca_ (2woc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349614Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
    multihelical; bundle
  4. 2349615Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families) (S)
  5. 2349620Family a.209.1.0: automated matches [191592] (1 protein)
    not a true family
  6. 2349621Protein automated matches [191071] (2 species)
    not a true protein
  7. 2349627Species Rhodospirillum rubrum [TaxId:1085] [196535] (3 PDB entries)
  8. 2349631Domain d2woca_: 2woc A: [206920]
    automated match to d2wodb_
    complexed with cl, fmt, gol, mn

Details for d2woca_

PDB Entry: 2woc (more details), 2.2 Å

PDB Description: crystal structure of the dinitrogenase reductase-activating glycohydrolase (drag) from rhodospirillum rubrum
PDB Compounds: (A:) ADP-ribosyl-[dinitrogen reductase] glycohydrolase

SCOPe Domain Sequences for d2woca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2woca_ a.209.1.0 (A:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
emslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtttapyseg
dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl

SCOPe Domain Coordinates for d2woca_:

Click to download the PDB-style file with coordinates for d2woca_.
(The format of our PDB-style files is described here.)

Timeline for d2woca_: