Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) automatically mapped to Pfam PF01179 |
Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins) |
Protein Copper amine oxidase, domain 3 [50000] (4 species) |
Species Escherichia coli [TaxId:562] [50001] (16 PDB entries) |
Domain d2wo0a4: 2wo0 A:301-725 [206915] Other proteins in same PDB: d2wo0a1, d2wo0a2, d2wo0a3, d2wo0b1, d2wo0b2, d2wo0b3 automated match to d1d6zb1 complexed with cu, na |
PDB Entry: 2wo0 (more details), 2.6 Å
SCOPe Domain Sequences for d2wo0a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wo0a4 b.30.2.1 (A:301-725) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]} pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl galkk
Timeline for d2wo0a4:
View in 3D Domains from other chains: (mouse over for more information) d2wo0b1, d2wo0b2, d2wo0b3, d2wo0b4 |