![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [54419] (16 PDB entries) |
![]() | Domain d2wo0a3: 2wo0 A:186-300 [206914] Other proteins in same PDB: d2wo0a1, d2wo0a4, d2wo0b1, d2wo0b4 automated match to d1d6zb3 complexed with cu, na |
PDB Entry: 2wo0 (more details), 2.6 Å
SCOPe Domain Sequences for d2wo0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wo0a3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]} mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d2wo0a3:
![]() Domains from other chains: (mouse over for more information) d2wo0b1, d2wo0b2, d2wo0b3, d2wo0b4 |