Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.1: Copper amine oxidase, domain N [55383] (2 families) automatically mapped to Pfam PF07833 |
Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein) |
Protein Copper amine oxidase, domain N [55385] (1 species) non-conserved N-terminal domain |
Species Escherichia coli [TaxId:562] [55386] (16 PDB entries) |
Domain d2wo0a1: 2wo0 A:7-90 [206912] Other proteins in same PDB: d2wo0a2, d2wo0a3, d2wo0a4, d2wo0b2, d2wo0b3, d2wo0b4 automated match to d1d6zb4 complexed with cu, na |
PDB Entry: 2wo0 (more details), 2.6 Å
SCOPe Domain Sequences for d2wo0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wo0a1 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]} mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn kawvsdtfindvfqsgldqtfqve
Timeline for d2wo0a1:
View in 3D Domains from other chains: (mouse over for more information) d2wo0b1, d2wo0b2, d2wo0b3, d2wo0b4 |