SCOPe 2.08: Domain d2wnrf2: 2wnr F:154-237

Lineage for d2wnrf2 (2wnr F:154-237)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.0: automated matches [227218] (1 protein)
   not a true family

6. Protein automated matches [226956] (5 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [225886] (1 PDB entry)

8. Domain d2wnrf2: 2wnr F:154-237 [206909]
   Other proteins in same PDB: d2wnra1, d2wnrb1, d2wnrc1, d2wnrd1, d2wnre1, d2wnrf1
   automated match to d2nn6b2
   complexed with po4

Details for d2wnrf2

PDB Entry: 2wnr, 2.65 Å

PDB Description: The structure of Methanothermobacter thermautotrophicus exosome core assembly

PDB Compounds: (F:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2wnrf2:

Sequence; same for both SEQRES and ATOM records:

>d2wnrf2 d.101.1.0 (F:154-237) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
pmrdmvvacaagkvgdqvvldlseeedkegqadvpvailprtreitllqsdgnltpeefe
raldlavegclrihevqkealrkr

Timeline for d2wnrf2:

• d2wnrf2 first appeared in SCOPe 2.03
  
• d2wnrf2 appears in SCOPe 2.07