Lineage for d2wnrf2 (2wnr F:154-237)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967341Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2967342Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2967494Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 2967495Protein automated matches [226956] (5 species)
    not a true protein
  7. 2967498Species Methanothermobacter thermautotrophicus [TaxId:145262] [225886] (1 PDB entry)
  8. 2967504Domain d2wnrf2: 2wnr F:154-237 [206909]
    Other proteins in same PDB: d2wnra1, d2wnrb1, d2wnrc1, d2wnrd1, d2wnre1, d2wnrf1
    automated match to d2nn6b2
    complexed with po4

Details for d2wnrf2

PDB Entry: 2wnr (more details), 2.65 Å

PDB Description: The structure of Methanothermobacter thermautotrophicus exosome core assembly
PDB Compounds: (F:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2wnrf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnrf2 d.101.1.0 (F:154-237) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
pmrdmvvacaagkvgdqvvldlseeedkegqadvpvailprtreitllqsdgnltpeefe
raldlavegclrihevqkealrkr

SCOPe Domain Coordinates for d2wnrf2:

Click to download the PDB-style file with coordinates for d2wnrf2.
(The format of our PDB-style files is described here.)

Timeline for d2wnrf2: