SCOPe 2.03: Domain d2wnid_: 2wni D:

Lineage for d2wnid_ (2wni D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.0: automated matches [196988] (1 protein)
   not a true family

6. Protein automated matches [196989] (7 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225887] (3 PDB entries)

8. Domain d2wnid_: 2wni D: [206903]
   automated match to d1dkla_
   complexed with so4

Details for d2wnid_

PDB Entry: 2wni, 2.57 Å

PDB Description: crystal structure analysis of klebsiella sp asr1 phytase

PDB Compounds: (D:) 3-phytase

SCOPe Domain Sequences for d2wnid_:

Sequence; same for both SEQRES and ATOM records:

>d2wnid_ c.60.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dwqlekvvelsragirpptagnreaieaatgrpwtewtthdgeltghgyaavvnkgreeg
qhyrqlgllqagcptaesiyvrasplqrtrataqalvdgafpgcgvaihyangdadplfq
tdkfaatqtdparqlaavkekagdlaqrrqalaptiqllkqavcqadkpcpifdtpwrve
qsksgkttisglsvmanmvetlrlgwsenlplsqlawgkiaqasqitallplltenydls
ndvlytaqkrgsvllnamldgvkpeaspnvrwlllvahdtniamvrtlmnfswqlpgysr
gnippgsslvlerwrdaksgerylrvyfqaqglddlrrlqtpdaqhpmlrqewrqpgcrq
tdvgtlcpfqaaitalgqridrpsapavamvlpk

Timeline for d2wnid_:

• d2wnid_ is new in SCOPe 2.03-stable
  
• d2wnid_ appears in SCOPe 2.04
  
• d2wnid_ appears in the current release, SCOPe 2.08, called d2wnid1