Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
Protein automated matches [196989] (7 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [225887] (3 PDB entries) |
Domain d2wnid_: 2wni D: [206903] automated match to d1dkla_ complexed with so4 |
PDB Entry: 2wni (more details), 2.57 Å
SCOPe Domain Sequences for d2wnid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnid_ c.60.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]} dwqlekvvelsragirpptagnreaieaatgrpwtewtthdgeltghgyaavvnkgreeg qhyrqlgllqagcptaesiyvrasplqrtrataqalvdgafpgcgvaihyangdadplfq tdkfaatqtdparqlaavkekagdlaqrrqalaptiqllkqavcqadkpcpifdtpwrve qsksgkttisglsvmanmvetlrlgwsenlplsqlawgkiaqasqitallplltenydls ndvlytaqkrgsvllnamldgvkpeaspnvrwlllvahdtniamvrtlmnfswqlpgysr gnippgsslvlerwrdaksgerylrvyfqaqglddlrrlqtpdaqhpmlrqewrqpgcrq tdvgtlcpfqaaitalgqridrpsapavamvlpk
Timeline for d2wnid_: