![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
![]() | Protein automated matches [196989] (16 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [225887] (3 PDB entries) |
![]() | Domain d2wnib1: 2wni B:13-405 [206901] Other proteins in same PDB: d2wnia2, d2wnia3, d2wnib2, d2wnic2, d2wnic3, d2wnid2 automated match to d1dkla_ complexed with so4 |
PDB Entry: 2wni (more details), 2.57 Å
SCOPe Domain Sequences for d2wnib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnib1 c.60.1.0 (B:13-405) automated matches {Klebsiella pneumoniae [TaxId: 573]} dwqlekvvelsragirpptagnreaieaatgrpwtewtthdgeltghgyaavvnkgreeg qhyrqlgllqagcptaesiyvrasplqrtrataqalvdgafpgcgvaihyangdadplfq tdkfaatqtdparqlaavkekagdlaqrrqalaptiqllkqavcqadkpcpifdtpwrve qsksgkttisglsvmanmvetlrlgwsenlplsqlawgkiaqasqitallplltenydls ndvlytaqkrgsvllnamldgvkpeaspnvrwlllvahdtniamvrtlmnfswqlpgysr gnippgsslvlerwrdaksgerylrvyfqaqglddlrrlqtpdaqhpmlrqewrqpgcrq tdvgtlcpfqaaitalgqridrpsapavamvlp
Timeline for d2wnib1: