Lineage for d2wnia1 (2wni A:13-405)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2891217Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2891218Protein automated matches [196989] (16 species)
    not a true protein
  7. 2891245Species Klebsiella pneumoniae [TaxId:573] [225887] (3 PDB entries)
  8. 2891252Domain d2wnia1: 2wni A:13-405 [206900]
    Other proteins in same PDB: d2wnia2, d2wnia3, d2wnib2, d2wnic2, d2wnic3, d2wnid2
    automated match to d1dkla_
    complexed with so4

Details for d2wnia1

PDB Entry: 2wni (more details), 2.57 Å

PDB Description: crystal structure analysis of klebsiella sp asr1 phytase
PDB Compounds: (A:) 3-phytase

SCOPe Domain Sequences for d2wnia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnia1 c.60.1.0 (A:13-405) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dwqlekvvelsragirpptagnreaieaatgrpwtewtthdgeltghgyaavvnkgreeg
qhyrqlgllqagcptaesiyvrasplqrtrataqalvdgafpgcgvaihyangdadplfq
tdkfaatqtdparqlaavkekagdlaqrrqalaptiqllkqavcqadkpcpifdtpwrve
qsksgkttisglsvmanmvetlrlgwsenlplsqlawgkiaqasqitallplltenydls
ndvlytaqkrgsvllnamldgvkpeaspnvrwlllvahdtniamvrtlmnfswqlpgysr
gnippgsslvlerwrdaksgerylrvyfqaqglddlrrlqtpdaqhpmlrqewrqpgcrq
tdvgtlcpfqaaitalgqridrpsapavamvlp

SCOPe Domain Coordinates for d2wnia1:

Click to download the PDB-style file with coordinates for d2wnia1.
(The format of our PDB-style files is described here.)

Timeline for d2wnia1: