Lineage for d1hhka1 (1hhk A:182-275)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364612Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 364613Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)
  8. 364670Domain d1hhka1: 1hhk A:182-275 [20690]
    Other proteins in same PDB: d1hhka2, d1hhkb_, d1hhkd2, d1hhke_

Details for d1hhka1

PDB Entry: 1hhk (more details), 2.5 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2

SCOP Domain Sequences for d1hhka1:

Sequence, based on SEQRES records: (download)

>d1hhka1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpl

Sequence, based on observed residues (ATOM records): (download)

>d1hhka1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1hhka1:

Click to download the PDB-style file with coordinates for d1hhka1.
(The format of our PDB-style files is described here.)

Timeline for d1hhka1: