Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (29 PDB entries) |
Domain d1hhka1: 1hhk A:182-275 [20690] Other proteins in same PDB: d1hhka2, d1hhkd2 |
PDB Entry: 1hhk (more details), 2.5 Å
SCOP Domain Sequences for d1hhka1:
Sequence, based on SEQRES records: (download)
>d1hhka1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpl
>d1hhka1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d1hhka1:
View in 3D Domains from other chains: (mouse over for more information) d1hhkb1, d1hhkd1, d1hhkd2, d1hhke1 |