SCOPe 2.08: Domain d2wnhb1: 2wnh B:13-405

Lineage for d2wnhb1 (2wnh B:13-405)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.0: automated matches [196988] (1 protein)
   not a true family

6. Protein automated matches [196989] (16 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225887] (3 PDB entries)

8. Domain d2wnhb1: 2wnh B:13-405 [206899]
   Other proteins in same PDB: d2wnha2, d2wnha3, d2wnhb2, d2wnhb3
   automated match to d1dkla_
   complexed with gol, mg, na

Details for d2wnhb1

PDB Entry: 2wnh, 1.68 Å

PDB Description: crystal structure analysis of klebsiella sp asr1 phytase

PDB Compounds: (B:) 3-phytase

SCOPe Domain Sequences for d2wnhb1:

Sequence; same for both SEQRES and ATOM records:

>d2wnhb1 c.60.1.0 (B:13-405) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dwqlekvvelsrhgirpptagnreaieaatgrpwtewtthdgeltghgyaavvnkgreeg
qhyrqlgllqagcptaesiyvrasplqrtrataqalvdgafpgcgvaihyangdadplfq
tdkfaatqtdparqlaavkekagdlaqrrqalaptiqllkqavcqadkpcpifdtpwrve
qsksgkttisglsvmanmvetlrlgwsenlplsqlawgkiaqasqitallplltenydls
ndvlytaqkrgsvllnamldgvkpeaspnvrwlllvahdtniamvrtlmnfswqlpgysr
gnippgsslvlerwrdaksgerylrvyfqaqglddlrrlqtpdaqhpmlrqewrqpgcrq
tdvgtlcpfqaaitalgqridrpsapavamvlp

Timeline for d2wnhb1:

• d2wnhb1 first appeared in SCOPe 2.03, called d2wnhb_
  
• d2wnhb1 appears in SCOPe 2.07