SCOPe 2.07: Domain d2wm8a1: 2wm8 A:2-162

Lineage for d2wm8a1 (2wm8 A:2-162)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.17: Magnesium-dependent phosphatase-1, Mdp1 [117509] (2 protein domains)
   the insertion subdomain is a 3-stranded beta-sheet different from the NIF family
   automatically mapped to Pfam PF03031
   automatically mapped to Pfam PF12689

6. Protein automated matches [227014] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225750] (1 PDB entry)

8. Domain d2wm8a1: 2wm8 A:2-162 [206887]
   Other proteins in same PDB: d2wm8a2
   automated match to d1u7oa_
   complexed with edo

Details for d2wm8a1

PDB Entry: 2wm8, 1.75 Å

PDB Description: crystal structure of human magnesium-dependent phosphatase 1 of the haloacid dehalogenase superfamily (mgc5987)

PDB Compounds: (A:) magnesium-dependent phosphatase 1

SCOPe Domain Sequences for d2wm8a1:

Sequence; same for both SEQRES and ATOM records:

>d2wm8a1 c.108.1.17 (A:2-162) automated matches {Human (Homo sapiens) [TaxId: 9606]}
marlpklavfdldytlwpfwvdthvdppfhkssdgtvrdrrgqdvrlypevpevlkrlqs
lgvpgaaasrtseieganqllelfdlfryfvhreiypgskithferlqqktgipfsqmif
fdderrnivdvsklgvtcihiqngmnlqtlsqgletfakaq

Timeline for d2wm8a1:

• d2wm8a1 first appeared in SCOPe 2.03, called d2wm8a_
  
• d2wm8a1 appears in SCOPe 2.06