![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.17: Magnesium-dependent phosphatase-1, Mdp1 [117509] (2 proteins) the insertion subdomain is a 3-stranded beta-sheet different from the NIF family automatically mapped to Pfam PF03031 automatically mapped to Pfam PF12689 |
![]() | Protein automated matches [227014] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225750] (1 PDB entry) |
![]() | Domain d2wm8a1: 2wm8 A:2-162 [206887] Other proteins in same PDB: d2wm8a2 automated match to d1u7oa_ complexed with edo |
PDB Entry: 2wm8 (more details), 1.75 Å
SCOPe Domain Sequences for d2wm8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wm8a1 c.108.1.17 (A:2-162) automated matches {Human (Homo sapiens) [TaxId: 9606]} marlpklavfdldytlwpfwvdthvdppfhkssdgtvrdrrgqdvrlypevpevlkrlqs lgvpgaaasrtseieganqllelfdlfryfvhreiypgskithferlqqktgipfsqmif fdderrnivdvsklgvtcihiqngmnlqtlsqgletfakaq
Timeline for d2wm8a1: