Lineage for d2wm8a1 (2wm8 A:2-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920158Family c.108.1.17: Magnesium-dependent phosphatase-1, Mdp1 [117509] (2 proteins)
    the insertion subdomain is a 3-stranded beta-sheet different from the NIF family
    automatically mapped to Pfam PF03031
    automatically mapped to Pfam PF12689
  6. 2920166Protein automated matches [227014] (1 species)
    not a true protein
  7. 2920167Species Human (Homo sapiens) [TaxId:9606] [225750] (1 PDB entry)
  8. 2920168Domain d2wm8a1: 2wm8 A:2-162 [206887]
    Other proteins in same PDB: d2wm8a2
    automated match to d1u7oa_
    complexed with edo

Details for d2wm8a1

PDB Entry: 2wm8 (more details), 1.75 Å

PDB Description: crystal structure of human magnesium-dependent phosphatase 1 of the haloacid dehalogenase superfamily (mgc5987)
PDB Compounds: (A:) magnesium-dependent phosphatase 1

SCOPe Domain Sequences for d2wm8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wm8a1 c.108.1.17 (A:2-162) automated matches {Human (Homo sapiens) [TaxId: 9606]}
marlpklavfdldytlwpfwvdthvdppfhkssdgtvrdrrgqdvrlypevpevlkrlqs
lgvpgaaasrtseieganqllelfdlfryfvhreiypgskithferlqqktgipfsqmif
fdderrnivdvsklgvtcihiqngmnlqtlsqgletfakaq

SCOPe Domain Coordinates for d2wm8a1:

Click to download the PDB-style file with coordinates for d2wm8a1.
(The format of our PDB-style files is described here.)

Timeline for d2wm8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wm8a2