SCOPe 2.08: Domain d2wlua_: 2wlu A:

Lineage for d2wlua_ (2wlu A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (60 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:1314] [225749] (3 PDB entries)

8. Domain d2wlua_: 2wlu A: [206886]
   automated match to d1o9rd_
   complexed with fe, gol, na

Details for d2wlua_

PDB Entry: 2wlu, 1.94 Å

PDB Description: iron-bound crystal structure of streptococcus pyogenes dpr

PDB Compounds: (A:) dps-like peroxide resistance protein

SCOPe Domain Sequences for d2wlua_:

Sequence, based on SEQRES records:

>d2wlua_ a.25.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
tlveniyasvthniskkeasknektkavlnqavadlsvaasivhqvhwymrgpgflylhp
kmdelldslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlarlve
vylylsslyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal

Sequence, based on observed residues (ATOM records):

>d2wlua_ a.25.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
tlveniyasvthnsknektkavlnqavadlsvaasivhqvhwymrgpgflylhpkmdell
dslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlarlvevylyls
slyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal

Timeline for d2wlua_:

• d2wlua_ first appeared in SCOPe 2.03
  
• d2wlua_ appears in SCOPe 2.07