![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Streptococcus pyogenes [TaxId:1314] [225749] (3 PDB entries) |
![]() | Domain d2wlaa_: 2wla A: [206883] automated match to d1o9rd_ complexed with gol |
PDB Entry: 2wla (more details), 2 Å
SCOPe Domain Sequences for d2wlaa_:
Sequence, based on SEQRES records: (download)
>d2wlaa_ a.25.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]} ntlveniyasvthniskkeasknektkavlnqavadlsvaasivhqvhwymrgpgflylh pkmdelldslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlarlv evylylsslyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal
>d2wlaa_ a.25.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]} ntlveniyasvthnsknektkavlnqavadlsvaasivhqvhwymrgpgflylhpkmdel ldslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlarlvevylyl sslyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal
Timeline for d2wlaa_: