SCOPe 2.08: Domain d2wl3d1: 2wl3 D:2-134

Lineage for d2wl3d1 (2wl3 D:2-134)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:186196] [225962] (2 PDB entries)

8. Domain d2wl3d1: 2wl3 D:2-134 [206881]
   automated match to d1lkda1
   complexed with ca, fe, gol

Details for d2wl3d1

PDB Entry: 2wl3, 2.2 Å

PDB Description: crystal structure of catechol 2,3-dioxygenase

PDB Compounds: (D:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d2wl3d1:

Sequence; same for both SEQRES and ATOM records:

>d2wl3d1 d.32.1.0 (D:2-134) automated matches {Rhodococcus sp. [TaxId: 186196]}
akvtelgylglsvsnldawrdyaagimgmqvvddgeddriylrmdrwhhrivlhadgsdd
layigwrvagpveldelaeqlknagipfevasdadaaerrvlglvklhdpggnpteifyg
pqvdtsspfhpgr

Timeline for d2wl3d1:

• d2wl3d1 first appeared in SCOPe 2.03
  
• d2wl3d1 appears in SCOPe 2.07