Lineage for d2wl3d1 (2wl3 D:2-134)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2943035Species Rhodococcus sp. [TaxId:186196] [225962] (2 PDB entries)
  8. 2943050Domain d2wl3d1: 2wl3 D:2-134 [206881]
    automated match to d1lkda1
    complexed with ca, fe, gol

Details for d2wl3d1

PDB Entry: 2wl3 (more details), 2.2 Å

PDB Description: crystal structure of catechol 2,3-dioxygenase
PDB Compounds: (D:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d2wl3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wl3d1 d.32.1.0 (D:2-134) automated matches {Rhodococcus sp. [TaxId: 186196]}
akvtelgylglsvsnldawrdyaagimgmqvvddgeddriylrmdrwhhrivlhadgsdd
layigwrvagpveldelaeqlknagipfevasdadaaerrvlglvklhdpggnpteifyg
pqvdtsspfhpgr

SCOPe Domain Coordinates for d2wl3d1:

Click to download the PDB-style file with coordinates for d2wl3d1.
(The format of our PDB-style files is described here.)

Timeline for d2wl3d1: