| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
| Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
| Protein automated matches [190239] (14 species) not a true protein |
| Species Rhodococcus sp. [TaxId:186196] [225962] (2 PDB entries) |
| Domain d2wl3c2: 2wl3 C:135-285 [206880] automated match to d1hana2 complexed with ca, fe, gol |
PDB Entry: 2wl3 (more details), 2.2 Å
SCOPe Domain Sequences for d2wl3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wl3c2 d.32.1.0 (C:135-285) automated matches {Rhodococcus sp. [TaxId: 186196]}
pmfgkfvtegqglghiiireddveeatrfyrllglegaveykfalpngavgtpvfmhcnd
rhhslafgvgpmdkrinhlmieythlddlgyahdlvrqqkidvtlqigkhsndealtfyc
anpsgwlwepgwgsrpapaqqehylrdifgh
Timeline for d2wl3c2: