SCOPe 2.04: Domain d2wjuf1: 2wju F:2-80

Lineage for d2wjuf1 (2wju F:2-80)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (91 PDB entries)

8. Domain d2wjuf1: 2wju F:2-80 [206867]
   Other proteins in same PDB: d2wjua2, d2wjub2, d2wjuc2, d2wjud2, d2wjue2, d2wjuf2, d2wjug2, d2wjuh2
   automated match to d1k3ya2
   complexed with gsh

Details for d2wjuf1

PDB Entry: 2wju, 2.3 Å

PDB Description: glutathione transferase a2-2 in complex with glutathione

PDB Compounds: (F:) glutathione-s-transferase a2-2

SCOPe Domain Sequences for d2wjuf1:

Sequence; same for both SEQRES and ATOM records:

>d2wjuf1 c.47.1.0 (F:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d2wjuf1:

• d2wjuf1 first appeared in SCOPe 2.03
  
• d2wjuf1 appears in SCOPe 2.05
  
• d2wjuf1 appears in the current release, SCOPe 2.08