SCOPe 2.03: Domain d2wjuc1: 2wju C:2-80

Lineage for d2wjuc1 (2wju C:2-80)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)

8. Domain d2wjuc1: 2wju C:2-80 [206861]
   Other proteins in same PDB: d2wjua2, d2wjub2, d2wjuc2, d2wjud2, d2wjue2, d2wjuf2, d2wjug2, d2wjuh2
   automated match to d1k3ya2
   complexed with gsh

Details for d2wjuc1

PDB Entry: 2wju, 2.3 Å

PDB Description: glutathione transferase a2-2 in complex with glutathione

PDB Compounds: (C:) glutathione-s-transferase a2-2

SCOPe Domain Sequences for d2wjuc1:

Sequence; same for both SEQRES and ATOM records:

>d2wjuc1 c.47.1.0 (C:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d2wjuc1:

• d2wjuc1 is new in SCOPe 2.03-stable
  
• d2wjuc1 appears in SCOPe 2.04
  
• d2wjuc1 appears in the current release, SCOPe 2.08