Lineage for d3hlaa1 (3hla A:182-270)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1759808Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1759809Species Human (Homo sapiens) [TaxId:9606] [88605] (189 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1759968Domain d3hlaa1: 3hla A:182-270 [20686]
    Other proteins in same PDB: d3hlaa2, d3hlab_

Details for d3hlaa1

PDB Entry: 3hla (more details), 2.6 Å

PDB Description: human class i histocompatibility antigen a2.1
PDB Compounds: (A:) class I histocompatibility antigen (hla-a2.1) (alpha chain)

SCOPe Domain Sequences for d3hlaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hlaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpl

SCOPe Domain Coordinates for d3hlaa1:

Click to download the PDB-style file with coordinates for d3hlaa1.
(The format of our PDB-style files is described here.)

Timeline for d3hlaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hlaa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3hlab_