Lineage for d2wjub1 (2wju B:2-80)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602752Species Human (Homo sapiens) [TaxId:9606] [188013] (91 PDB entries)
  8. 1602933Domain d2wjub1: 2wju B:2-80 [206859]
    Other proteins in same PDB: d2wjua2, d2wjub2, d2wjuc2, d2wjud2, d2wjue2, d2wjuf2, d2wjug2, d2wjuh2
    automated match to d1k3ya2
    complexed with gsh

Details for d2wjub1

PDB Entry: 2wju (more details), 2.3 Å

PDB Description: glutathione transferase a2-2 in complex with glutathione
PDB Compounds: (B:) glutathione-s-transferase a2-2

SCOPe Domain Sequences for d2wjub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wjub1 c.47.1.0 (B:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d2wjub1:

Click to download the PDB-style file with coordinates for d2wjub1.
(The format of our PDB-style files is described here.)

Timeline for d2wjub1: