Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (133 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (91 PDB entries) |
Domain d2wjub1: 2wju B:2-80 [206859] Other proteins in same PDB: d2wjua2, d2wjub2, d2wjuc2, d2wjud2, d2wjue2, d2wjuf2, d2wjug2, d2wjuh2 automated match to d1k3ya2 complexed with gsh |
PDB Entry: 2wju (more details), 2.3 Å
SCOPe Domain Sequences for d2wjub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wjub1 c.47.1.0 (B:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]} aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid gmklvqtrailnyiaskyn
Timeline for d2wjub1: