Lineage for d2wjoa_ (2wjo A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2393721Protein automated matches [190156] (5 species)
    not a true protein
  7. 2393747Species Human (Homo sapiens) [TaxId:9606] [187237] (38 PDB entries)
  8. 2393781Domain d2wjoa_: 2wjo A: [206856]
    automated match to d4fm8a_
    complexed with qud

Details for d2wjoa_

PDB Entry: 2wjo (more details), 2.5 Å

PDB Description: human bace (beta secretase) in complex with cyclohexanecarboxylic acid (2-(2-am ino-6-phenoxy-4h-quinazolin-3-yl)-2-cyclohexyl-ethyl)-amide
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d2wjoa_:

Sequence, based on SEQRES records: (download)

>d2wjoa_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgynipq

Sequence, based on observed residues (ATOM records): (download)

>d2wjoa_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgalasvggsmiiggidhslytgs
lwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavks
ikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylr
pvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrt
aavegpfvtldmedcgynipq

SCOPe Domain Coordinates for d2wjoa_:

Click to download the PDB-style file with coordinates for d2wjoa_.
(The format of our PDB-style files is described here.)

Timeline for d2wjoa_: