| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Methanocaldococcus jannaschii [TaxId:2190] [225748] (4 PDB entries) |
| Domain d2wjhb_: 2wjh B: [206851] automated match to d2cxxa1 complexed with flc, gdp, mg |
PDB Entry: 2wjh (more details), 2.1 Å
SCOPe Domain Sequences for d2wjhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wjhb_ c.37.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvdlpgv
ysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllalnkmdl
akslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkdl
Timeline for d2wjhb_: