Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (91 PDB entries) |
Domain d1i1ye_: 1i1y E: [20685] Other proteins in same PDB: d1i1ya1, d1i1ya2, d1i1yd1, d1i1yd2 |
PDB Entry: 1i1y (more details), 2.2 Å
SCOP Domain Sequences for d1i1ye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1ye_ b.1.1.2 (E:) beta2-microglobulin {Human (Homo sapiens)} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1i1ye_: