Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (79 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:2190] [225748] (5 PDB entries) |
Domain d2wjgb_: 2wjg B: [206849] automated match to d2cxxa1 complexed with gdp |
PDB Entry: 2wjg (more details), 2.2 Å
SCOPe Domain Sequences for d2wjgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wjgb_ c.37.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} hmksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvdlpg vysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllalnkmd lakslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkd
Timeline for d2wjgb_: