Lineage for d2wjga_ (2wjg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872491Species Methanocaldococcus jannaschii [TaxId:2190] [225748] (4 PDB entries)
  8. 2872498Domain d2wjga_: 2wjg A: [206848]
    automated match to d2cxxa1
    complexed with gdp

Details for d2wjga_

PDB Entry: 2wjg (more details), 2.2 Å

PDB Description: structure and function of the feob g-domain from methanococcus jannaschii
PDB Compounds: (A:) ferrous iron transport protein b homolog

SCOPe Domain Sequences for d2wjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wjga_ c.37.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
ggshmksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvd
lpgvysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllaln
kmdlakslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkdk

SCOPe Domain Coordinates for d2wjga_:

Click to download the PDB-style file with coordinates for d2wjga_.
(The format of our PDB-style files is described here.)

Timeline for d2wjga_: