SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2wjga_ (2wjg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (121 species)
    not a true protein
  7. 2114436Species Methanocaldococcus jannaschii [TaxId:2190] [225748] (5 PDB entries)
  8. 2114441Domain d2wjga_: 2wjg A: [206848]
    automated match to d2cxxa1
    complexed with gdp

Details for d2wjga_

PDB Entry: 2wjg (more details), 2.2 Å

PDB Description: structure and function of the feob g-domain from methanococcus jannaschii
PDB Compounds: (A:) ferrous iron transport protein b homolog

SCOPe Domain Sequences for d2wjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wjga_ c.37.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
ggshmksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvd
lpgvysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllaln
kmdlakslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkdk

SCOPe Domain Coordinates for d2wjga_:

Click to download the PDB-style file with coordinates for d2wjga_.
(The format of our PDB-style files is described here.)

Timeline for d2wjga_: