SCOPe 2.08: Domain d2wjaa1: 2wja A:1-147

Lineage for d2wjaa1 (2wja A:1-147)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (20 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189034] (2 PDB entries)

8. Domain d2wjaa1: 2wja A:1-147 [206846]
   Other proteins in same PDB: d2wjaa2
   automated match to d2wmyf_
   complexed with ni, po4

Details for d2wjaa1

PDB Entry: 2wja, 2.5 Å

PDB Description: crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with phosphate.

PDB Compounds: (A:) putative acid phosphatase wzb

SCOPe Domain Sequences for d2wjaa1:

Sequence, based on SEQRES records:

>d2wjaa1 c.44.1.0 (A:1-147) automated matches {Escherichia coli [TaxId: 562]}
maklmfdsilvictgnicrspigerllrrllpskkinsagvgalvdhaadesairvaekn
glclkghrgtkftsalarqydlllvmeyshleqisriapeargktmlfghwldskeipdp
yrmsdeafdsvyqlleqaskrwaeklg

Sequence, based on observed residues (ATOM records):

>d2wjaa1 c.44.1.0 (A:1-147) automated matches {Escherichia coli [TaxId: 562]}
maklmfdsilvictgnicrspigerllrrllpskkinsagvgalvdhaadesairvnglc
lkghrgtkftsalarqydlllvmeyshleqisriapeargktmlfghwkeipdpyrmsde
afdsvyqlleqaskrwaeklg

Timeline for d2wjaa1:

• d2wjaa1 first appeared in SCOPe 2.03, called d2wjaa_
  
• d2wjaa1 appears in SCOPe 2.07