Lineage for d2wiqb_ (2wiq B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407957Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1407958Protein automated matches [190526] (17 species)
    not a true protein
  7. 1407965Species Anthomedusae sp. [TaxId:328397] [194158] (5 PDB entries)
  8. 1407969Domain d2wiqb_: 2wiq B: [206839]
    automated match to d3st2c_
    complexed with na, so4

Details for d2wiqb_

PDB Entry: 2wiq (more details), 2 Å

PDB Description: fluorescent protein killerred in the native state
PDB Compounds: (B:) KillerRed

SCOPe Domain Sequences for d2wiqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wiqb_ d.22.1.0 (B:) automated matches {Anthomedusae sp. [TaxId: 328397]}
eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsai

SCOPe Domain Coordinates for d2wiqb_:

Click to download the PDB-style file with coordinates for d2wiqb_.
(The format of our PDB-style files is described here.)

Timeline for d2wiqb_: