Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (17 species) not a true protein |
Species Anthomedusae sp. [TaxId:328397] [194158] (5 PDB entries) |
Domain d2wiqb_: 2wiq B: [206839] automated match to d3st2c_ complexed with na, so4 |
PDB Entry: 2wiq (more details), 2 Å
SCOPe Domain Sequences for d2wiqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wiqb_ d.22.1.0 (B:) automated matches {Anthomedusae sp. [TaxId: 328397]} eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsai
Timeline for d2wiqb_: