Lineage for d2wiqa_ (2wiq A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643884Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1643885Protein automated matches [190526] (18 species)
    not a true protein
  7. 1643901Species Anthomedusae sp. [TaxId:328397] [194158] (5 PDB entries)
  8. 1643904Domain d2wiqa_: 2wiq A: [206838]
    automated match to d3st2c_
    complexed with na, so4

Details for d2wiqa_

PDB Entry: 2wiq (more details), 2 Å

PDB Description: fluorescent protein killerred in the native state
PDB Compounds: (A:) KillerRed

SCOPe Domain Sequences for d2wiqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wiqa_ d.22.1.0 (A:) automated matches {Anthomedusae sp. [TaxId: 328397]}
eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvprit

SCOPe Domain Coordinates for d2wiqa_:

Click to download the PDB-style file with coordinates for d2wiqa_.
(The format of our PDB-style files is described here.)

Timeline for d2wiqa_: