SCOPe 2.03: Domain d2wiqa_: 2wiq A:

Lineage for d2wiqa_ (2wiq A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (17 species)
   not a true protein

7. Species Anthomedusae sp. [TaxId:328397] [194158] (5 PDB entries)

8. Domain d2wiqa_: 2wiq A: [206838]
   automated match to d3st2c_
   complexed with na, so4

Details for d2wiqa_

PDB Entry: 2wiq, 2 Å

PDB Description: fluorescent protein killerred in the native state

PDB Compounds: (A:) KillerRed

SCOPe Domain Sequences for d2wiqa_:

Sequence; same for both SEQRES and ATOM records:

>d2wiqa_ d.22.1.0 (A:) automated matches {Anthomedusae sp. [TaxId: 328397]}
eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvprit

Timeline for d2wiqa_:

• d2wiqa_ is new in SCOPe 2.03-stable
  
• d2wiqa_ appears in SCOPe 2.04
  
• d2wiqa_ appears in the current release, SCOPe 2.08