SCOPe 2.05: Domain d2whtd_: 2wht D:

Lineage for d2whtd_ (2wht D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (16 species)
   not a true protein

7. Species Montipora sp. [TaxId:321802] [189025] (4 PDB entries)

8. Domain d2whtd_: 2wht D: [206833]
   automated match to d3neda_

Details for d2whtd_

PDB Entry: 2wht, 1.9 Å

PDB Description: fluorescent protein mkeima at ph 5.6

PDB Compounds: (D:) Large stokes shift fluorescent protein

SCOPe Domain Sequences for d2whtd_:

Sequence; same for both SEQRES and ATOM records:

>d2whtd_ d.22.1.1 (D:) automated matches {Montipora sp. [TaxId: 321802]}
sviakqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilspql
qygsipftkypedipdyfkqsfpegytwersmnfedgavctvsndssiqgncfiynvkis
genfppngpvmqkktqgwepsterlfardgmligndymalkleggghylcefkstykakk
pvrmpgrheidrkldvtshnrdytsveqceiaiarhsl

Timeline for d2whtd_:

• d2whtd_ first appeared in SCOPe 2.03
  
• d2whtd_ appears in SCOPe 2.04
  
• d2whtd_ appears in SCOPe 2.06
  
• d2whtd_ appears in the current release, SCOPe 2.08