![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Montipora sp. [TaxId:321802] [189025] (4 PDB entries) |
![]() | Domain d2whsc_: 2whs C: [206828] Other proteins in same PDB: d2whsb2, d2whsd2 automated match to d3neda_ complexed with so4 |
PDB Entry: 2whs (more details), 2.1 Å
SCOPe Domain Sequences for d2whsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2whsc_ d.22.1.1 (C:) automated matches {Montipora sp. [TaxId: 321802]} sviakqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilspql qygsipftkypedipdyfkqsfpegytwersmnfedgavctvsndssiqgncfiynvkis genfppngpvmqkktqgwepsterlfardgmligndymalkleggghylcefkstykakk pvrmpgrheidrkldvtshnrdytsveqceiaiarhsl
Timeline for d2whsc_: