SCOPe 2.08: Domain d2whsb1: 2whs B:0-221

Lineage for d2whsb1 (2whs B:0-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Montipora sp. [TaxId:321802] [189025] (4 PDB entries)

8. Domain d2whsb1: 2whs B:0-221 [206827]
   Other proteins in same PDB: d2whsb2, d2whsd2
   automated match to d3neda_
   complexed with so4

Details for d2whsb1

PDB Entry: 2whs, 2.1 Å

PDB Description: fluorescent protein mkeima at ph 3.8

PDB Compounds: (B:) Large stokes shift fluorescent protein

SCOPe Domain Sequences for d2whsb1:

Sequence; same for both SEQRES and ATOM records:

>d2whsb1 d.22.1.1 (B:0-221) automated matches {Montipora sp. [TaxId: 321802]}
mvsviakqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilsp
qlqygsipftkypedipdyfkqsfpegytwersmnfedgavctvsndssiqgncfiynvk
isgenfppngpvmqkktqgwepsterlfardgmligndymalkleggghylcefkstyka
kkpvrmpgrheidrkldvtshnrdytsveqceiaiarhsllg

Timeline for d2whsb1:

• d2whsb1 first appeared in SCOPe 2.03, called d2whsb_
  
• d2whsb1 appears in SCOPe 2.07