Lineage for d2whsb1 (2whs B:0-221)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940506Species Montipora sp. [TaxId:321802] [189025] (4 PDB entries)
  8. 2940514Domain d2whsb1: 2whs B:0-221 [206827]
    Other proteins in same PDB: d2whsb2, d2whsd2
    automated match to d3neda_
    complexed with so4

Details for d2whsb1

PDB Entry: 2whs (more details), 2.1 Å

PDB Description: fluorescent protein mkeima at ph 3.8
PDB Compounds: (B:) Large stokes shift fluorescent protein

SCOPe Domain Sequences for d2whsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2whsb1 d.22.1.1 (B:0-221) automated matches {Montipora sp. [TaxId: 321802]}
mvsviakqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilsp
qlqygsipftkypedipdyfkqsfpegytwersmnfedgavctvsndssiqgncfiynvk
isgenfppngpvmqkktqgwepsterlfardgmligndymalkleggghylcefkstyka
kkpvrmpgrheidrkldvtshnrdytsveqceiaiarhsllg

SCOPe Domain Coordinates for d2whsb1:

Click to download the PDB-style file with coordinates for d2whsb1.
(The format of our PDB-style files is described here.)

Timeline for d2whsb1: