| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
| Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
| Protein automated matches [226862] (5 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries) |
| Domain d2wgsj1: 2wgs J:4-104 [206804] Other proteins in same PDB: d2wgsa2, d2wgsb2, d2wgsc2, d2wgsd2, d2wgse2, d2wgsf2, d2wgsg2, d2wgsh2, d2wgsi2, d2wgsj2, d2wgsk2, d2wgsl2 automated match to d1f52a1 complexed with 1az, cl |
PDB Entry: 2wgs (more details), 2.55 Å
SCOPe Domain Sequences for d2wgsj1:
Sequence, based on SEQRES records: (download)
>d2wgsj1 d.15.9.0 (J:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy
>d2wgsj1 d.15.9.0 (J:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
dmlllpdpetaridpfraaktlninffvhdpftlepy
Timeline for d2wgsj1: