Lineage for d2wgsi1 (2wgs I:4-104)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934813Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2934938Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2934939Protein automated matches [226862] (5 species)
    not a true protein
  7. 2935027Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries)
  8. 2935066Domain d2wgsi1: 2wgs I:4-104 [206802]
    Other proteins in same PDB: d2wgsa2, d2wgsb2, d2wgsc2, d2wgsd2, d2wgse2, d2wgsf2, d2wgsg2, d2wgsh2, d2wgsi2, d2wgsj2, d2wgsk2, d2wgsl2
    automated match to d1f52a1
    complexed with 1az, cl

Details for d2wgsi1

PDB Entry: 2wgs (more details), 2.55 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor.
PDB Compounds: (I:) glutamine synthetase 1

SCOPe Domain Sequences for d2wgsi1:

Sequence, based on SEQRES records: (download)

>d2wgsi1 d.15.9.0 (I:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy

Sequence, based on observed residues (ATOM records): (download)

>d2wgsi1 d.15.9.0 (I:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
dmlllpdpetaridpfraaktlninffvhdpftlepy

SCOPe Domain Coordinates for d2wgsi1:

Click to download the PDB-style file with coordinates for d2wgsi1.
(The format of our PDB-style files is described here.)

Timeline for d2wgsi1: