SCOP 1.65: Domain d2clrd1: 2clr D:182-275

Lineage for d2clrd1 (2clr D:182-275)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (56 PDB entries)

8. Domain d2clrd1: 2clr D:182-275 [20680]
   Other proteins in same PDB: d2clra2, d2clrb_, d2clrd2, d2clre_

Details for d2clrd1

PDB Entry: 2clr, 2 Å

PDB Description: three dimensional structure of a peptide extending out one end of a class i mhc binding site

SCOP Domain Sequences for d2clrd1:

Sequence; same for both SEQRES and ATOM records:

>d2clrd1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d2clrd1:

• d2clrd1 first appeared (with stable ids) in SCOP 1.55
  
• d2clrd1 appears in SCOP 1.63
  
• d2clrd1 appears in SCOP 1.67
  
• d2clrd1 appears in the current release, SCOPe 2.08