SCOP 1.59: Domain d2clrd1: 2clr D:182-275

Lineage for d2clrd1 (2clr D:182-275)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (28 PDB entries)

8. Domain d2clrd1: 2clr D:182-275 [20680]
   Other proteins in same PDB: d2clra2, d2clrd2

Details for d2clrd1

PDB Entry: 2clr, 2 Å

PDB Description: three dimensional structure of a peptide extending out one end of a class i mhc binding site

SCOP Domain Sequences for d2clrd1:

Sequence; same for both SEQRES and ATOM records:

>d2clrd1 b.1.1.2 (D:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d2clrd1:

• d2clrd1 first appeared (with stable ids) in SCOP 1.55
  
• d2clrd1 appears in SCOP 1.57
  
• d2clrd1 appears in SCOP 1.61
  
• d2clrd1 appears in the current release, SCOPe 2.08