Lineage for d2wgqb4 (2wgq B:301-727)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309061Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1309062Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1309063Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1309064Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1309130Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 1309162Domain d2wgqb4: 2wgq B:301-727 [206785]
    Other proteins in same PDB: d2wgqa1, d2wgqa2, d2wgqa3, d2wgqb1, d2wgqb2, d2wgqb3
    automated match to d1oacb1
    complexed with ca, zn

Details for d2wgqb4

PDB Entry: 2wgq (more details), 2.5 Å

PDB Description: zinc substituted e coli copper amine oxidase, a model for the precursor for 2,4,5-trihydroxyphenylalaninequinone formation
PDB Compounds: (B:) amine oxidase

SCOPe Domain Sequences for d2wgqb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wgqb4 b.30.2.1 (B:301-727) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkkdk

SCOPe Domain Coordinates for d2wgqb4:

Click to download the PDB-style file with coordinates for d2wgqb4.
(The format of our PDB-style files is described here.)

Timeline for d2wgqb4: