| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
| Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
| Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
| Species Escherichia coli [TaxId:562] [54419] (16 PDB entries) |
| Domain d2wgqb3: 2wgq B:186-300 [206784] Other proteins in same PDB: d2wgqa1, d2wgqa4, d2wgqb1, d2wgqb4 automated match to d1oacb3 complexed with ca, zn |
PDB Entry: 2wgq (more details), 2.5 Å
SCOPe Domain Sequences for d2wgqb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wgqb3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d2wgqb3:
View in 3DDomains from other chains: (mouse over for more information) d2wgqa1, d2wgqa2, d2wgqa3, d2wgqa4 |