Lineage for d2wgqb1 (2wgq B:5-90)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422562Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 1422563Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
    automatically mapped to Pfam PF07833
  5. 1422564Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 1422565Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 1422566Species Escherichia coli [TaxId:562] [55386] (16 PDB entries)
  8. 1422598Domain d2wgqb1: 2wgq B:5-90 [206782]
    Other proteins in same PDB: d2wgqa2, d2wgqa3, d2wgqa4, d2wgqb2, d2wgqb3, d2wgqb4
    automated match to d1oacb4
    complexed with ca, zn

Details for d2wgqb1

PDB Entry: 2wgq (more details), 2.5 Å

PDB Description: zinc substituted e coli copper amine oxidase, a model for the precursor for 2,4,5-trihydroxyphenylalaninequinone formation
PDB Compounds: (B:) amine oxidase

SCOPe Domain Sequences for d2wgqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wgqb1 d.82.1.1 (B:5-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
ahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmk
dnkawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d2wgqb1:

Click to download the PDB-style file with coordinates for d2wgqb1.
(The format of our PDB-style files is described here.)

Timeline for d2wgqb1: