![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) ![]() automatically mapped to Pfam PF01179 |
![]() | Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins) |
![]() | Protein Copper amine oxidase, domain 3 [50000] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [50001] (16 PDB entries) |
![]() | Domain d2wgqa4: 2wgq A:301-724 [206781] Other proteins in same PDB: d2wgqa1, d2wgqa2, d2wgqa3, d2wgqb1, d2wgqb2, d2wgqb3 automated match to d1oaca1 complexed with ca, zn |
PDB Entry: 2wgq (more details), 2.5 Å
SCOPe Domain Sequences for d2wgqa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wgqa4 b.30.2.1 (A:301-724) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]} pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl galk
Timeline for d2wgqa4:
![]() Domains from other chains: (mouse over for more information) d2wgqb1, d2wgqb2, d2wgqb3, d2wgqb4 |