Lineage for d2wgqa3 (2wgq A:186-300)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1404785Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1404786Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1404787Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1404917Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 1404979Domain d2wgqa3: 2wgq A:186-300 [206780]
    Other proteins in same PDB: d2wgqa1, d2wgqa4, d2wgqb1, d2wgqb4
    automated match to d1oaca3
    complexed with ca, zn

Details for d2wgqa3

PDB Entry: 2wgq (more details), 2.5 Å

PDB Description: zinc substituted e coli copper amine oxidase, a model for the precursor for 2,4,5-trihydroxyphenylalaninequinone formation
PDB Compounds: (A:) amine oxidase

SCOPe Domain Sequences for d2wgqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wgqa3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOPe Domain Coordinates for d2wgqa3:

Click to download the PDB-style file with coordinates for d2wgqa3.
(The format of our PDB-style files is described here.)

Timeline for d2wgqa3: