SCOPe 2.07: Domain d2weia1: 2wei A:70-338

Lineage for d2weia1 (2wei A:70-338)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [196400] (5 PDB entries)

8. Domain d2weia1: 2wei A:70-338 [206777]
   Other proteins in same PDB: d2weia2
   automated match to d2qkra_
   complexed with vgg

Details for d2weia1

PDB Entry: 2wei, 1.65 Å

PDB Description: crystal structure of the kinase domain of cryptosporidium parvum calcium dependent protein kinase in complex with 3-mb-pp1

PDB Compounds: (A:) calmodulin-domain protein kinase 1, putative

SCOPe Domain Sequences for d2weia1:

Sequence; same for both SEQRES and ATOM records:

>d2weia1 d.144.1.0 (A:70-338) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gtfaerynivcmlgkgsfgevlkckdritqqeyavkvinkasaknkdtstilrevellkk
ldhpnimklfeiledsssfyivgelytggelfdeiikrkrfsehdaariikqvfsgitym
hkhnivhrdlkpenilleskekdcdikiidfglstcfqqntkmkdrigtayyiapevlrg
tydekcdvwsagvilyillsgtppfygkneydilkrvetgkyafdlpqwrtisddakdli
rkmltfhpslritatqclehpwiqkysse

Timeline for d2weia1:

• d2weia1 first appeared in SCOPe 2.03, called d2weia_
  
• d2weia1 appears in SCOPe 2.06
  
• d2weia1 appears in the current release, SCOPe 2.08